PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI06G04170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 450aa    MW: 50695.9 Da    PI: 6.99
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI06G04170.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-17149195148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd +lv++v+q+G + W+ Ia+ ++ gR +kqc++rw+++l
  ORUFI06G04170.1 149 KGQWTLEEDRKLVKLVEQFGLRKWSHIAQILP-GRVGKQCRERWHNHL 195
                      799*****************************.*************97 PP

2Myb_DNA-binding51.62.1e-16201243145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eEd  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
  ORUFI06G04170.1 201 KDTWSEEEDIVLIQTHKEVGNK-WAEIAKHLP-GRTENSIKNHWN 243
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.59144199IPR017930Myb domain
SuperFamilySSF466891.01E-31146242IPR009057Homeodomain-like
SMARTSM007171.6E-15148197IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-27150202IPR009057Homeodomain-like
PfamPF139214.6E-20152211No hitNo description
CDDcd001672.58E-15152195No hitNo description
PROSITE profilePS5129421.249200250IPR017930Myb domain
SMARTSM007171.3E-15200248IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-22203248IPR009057Homeodomain-like
CDDcd001672.09E-12203246No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MRRAAGWGIF CDVEFAPRDA GGFGRLMNAK QNGHQELHLV DHPFNNVTDG HEYYSPSAGG  60
SFLPFATYYD LGHEYYPQGG EKDAVVVDRA SPTIRKASPH LPLFTPKSEV SHLIGGGVVG  120
SYKAFEMNSR LIRRKRASGK SLKKANVVKG QWTLEEDRKL VKLVEQFGLR KWSHIAQILP  180
GRVGKQCRER WHNHLRPNIK KDTWSEEEDI VLIQTHKEVG NKWAEIAKHL PGRTENSIKN  240
HWNATKRRQF ARRRSRASSK NPKSGTLLQN YIKSLGIGPI KSSVRQAPPE STAVSSSSPA  300
STQKLAEVNG KIRPDSNPSN QMVTQGILTM DENSYIQTNS CEELLVSTYD DLCLDMCDHL  360
FETKDETPYQ VYNIDDDVDM NYIFNHIDYA NKIGHEIDME MAWDDDVLQD DESAGSSPLE  420
TPAGLAQINT VHVKEEMDLI EMVTRTQSCG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-431472502105MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-431472502105C-Myb DNA-Binding Domain
1msf_C4e-431472502105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2418120.0AK241812.1 Oryza sativa Japonica Group cDNA, clone: J065210K15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641269.10.0PREDICTED: myb-related protein A isoform X1
TrEMBLA0A0E0PTW50.0A0A0E0PTW5_ORYRU; Uncharacterized protein
STRINGBGIOSGA022369-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.14e-64myb domain protein 98